CNN3 monoclonal antibody (M03), clone 2C7

• Catalog Number: orb2294292
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CNN3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• NCBI: NP_001830.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CNN3 monoclonal antibody (M03), clone 2C7. Western Blot analysis of CNN3 expression in HepG2.

Western Blot analysis of CNN3 expression in transfected 293T cell line by CNN3 monoclonal antibody (M03), clone 2C7. Lane 1: CNN3 transfected lysate (Predicted MW: 36.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (62.8 KDa).