CNN3 monoclonal antibody (M01), clone 4C4

• Catalog Number: orb2294293
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CNN3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• NCBI: NP_001830.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CNN3 monoclonal antibody (M01), clone 4C4. Western Blot analysis of CNN3 expression in HepG2.

Detection limit for recombinant GST tagged CNN3 is 0.1 ng/ml as a capture antibody.

Western Blot analysis of CNN3 expression in transfected 293T cell line by CNN3 monoclonal antibody (M01), clone 4C4. Lane 1: CNN3 transfected lysate (Predicted MW: 36.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (62.8 KDa).