You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294297 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human CNN2 protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | IF, WB |
Reactivity | Human |
Immunogen | CNN2 (NP_958434.1, 1 a.a. ~ 270 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY |
NCBI | NP_958434.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Application notes | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of purified MaxPab antibody to CNN2 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of CNN2 expression in transfected 293T cell line by CNN2 MaxPab polyclonal antibody. Lane 1: CNN2 transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate.