You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290625 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CNKSR3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4A11 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | CNKSR3 (NP_775786, 366 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY |
NCBI | NP_775786 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged CNKSR3 is 0.1 ng/ml as a capture antibody.
Immunoprecipitation of CNKSR3 transfected lysate using anti-CNKSR3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CNKSR3 MaxPab rabbit polyclonal antibody.
Western Blot analysis of CNKSR3 expression in transfected 293T cell line by CNKSR3 monoclonal antibody (M01), clone 4A11. Lane 1: CNKSR3 transfected lysate (Predicted MW: 61.9 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).