CNKSR3 monoclonal antibody (M01), clone 4A11

• Catalog Number: orb2290625
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CNKSR3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A11
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CNKSR3 (NP_775786, 366 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY
• NCBI: NP_775786
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CNKSR3 is 0.1 ng/ml as a capture antibody.

Immunoprecipitation of CNKSR3 transfected lysate using anti-CNKSR3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CNKSR3 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CNKSR3 expression in transfected 293T cell line by CNKSR3 monoclonal antibody (M01), clone 4A11. Lane 1: CNKSR3 transfected lysate (Predicted MW: 61.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).