You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294359 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CLU. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE |
Tested applications | ELISA, WB |
Clone Number | 1A11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001822.2 |
CLU monoclonal antibody (M01), clone 1A11. Western Blot analysis of CLU expression in human pancreas.
Detection limit for recombinant GST tagged CLU is approximately 0.1 ng/ml as a capture antibody.
Western Blot analysis of CLU expression in transfected 293T cell line by CLU monoclonal antibody (M01), clone 1A11. Lane 1: CLU transfected lysate (Predicted MW: 49.39 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).