CLTB purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294319
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CLTB protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: CLTB (NP_001825.1, 1 a.a. ~ 211 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• NCBI: NP_001825.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in human stomach.

CLTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CLTB expression in mouse spleen.

Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB MaxPab rabbit polyclonal antibody. Lane 1: CLTB transfected lysate(23.20 KDa). Lane 2: Non-transfected lysate.