CLTB monoclonal antibody (M01A), clone S1

• Catalog Number: orb2294317
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CLTB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• NCBI: AAH06457
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLTB monoclonal antibody (M01A), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7.

Western Blot detection against Immunogen (48.95 KDa).