You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294318 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CLTB. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4B12-1E3 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2b kappa |
Immunogen | CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR |
NCBI | AAH06457 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CLTB monoclonal antibody (M01), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7.
Detection limit for recombinant GST tagged CLTB is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CLTB on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CLTB on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml].
Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB monoclonal antibody (M01), clone 4B12-1E3. Lane 1: CLTB transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (48.95 KDa).