CLTB monoclonal antibody (M01), clone 4B12-1E3

• Catalog Number: orb2294318
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CLTB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4B12-1E3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: CLTB (AAH06457, 1 a.a. ~ 211 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• NCBI: AAH06457
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLTB monoclonal antibody (M01), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7.

Detection limit for recombinant GST tagged CLTB is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CLTB on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CLTB on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml].

Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB monoclonal antibody (M01), clone 4B12-1E3. Lane 1: CLTB transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (48.95 KDa).