You have no items in your shopping cart.
Cart summary
ClpP Protein, Clostridium botulinum, Recombinant (His & SUMO)
Catalog Number: orb1979503
| Catalog Number | orb1979503 |
|---|---|
| Category | Proteins |
| Description | ClpP Protein, Clostridium botulinum, Recombinant (His & SUMO) is expressed in E. coli. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 37.5 kDa (predicted) |
| UniProt ID | A5I6W1 |
| Protein Sequence | MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK |
| Expression System | E. coli |
| Biological Origin | Clostridium botulinum |
| Biological Activity | ClpP Protein, Clostridium botulinum, Recombinant (His & SUMO) is expressed in E. coli. |
| Expression Region | 1-194 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
