CLPP monoclonal antibody (M01), clone 3E2

• Catalog Number: orb2291908
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CLPP.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
• NCBI: NP_006003
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLPP monoclonal antibody (M01), clone 3E2 Western Blot analysis of CLPP expression in A-431.

CLPP monoclonal antibody (M01), clone 3E2. Western Blot analysis of CLPP expression in PC-12.

Detection limit for recombinant GST tagged CLPP is 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CLPP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).