CLK3 monoclonal antibody (M07A), clone 7D6

• Catalog Number: orb2294342
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CLK3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7D6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
• NCBI: AAH02555
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLK3 monoclonal antibody (M07A), clone 7D6 Western Blot analysis of CLK3 expression in MCF-7.

Western Blot detection against Immunogen (36.74 KDa).