You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294343 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CLK3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 7D6 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV |
NCBI | AAH02555 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CLK3 monoclonal antibody (M07), clone 7D6 Western Blot analysis of CLK3 expression in MCF-7.
Immunofluorescence of monoclonal antibody to CLK3 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml].
Western Blot detection against Immunogen (36.74 KDa).