CLK3 monoclonal antibody (M01), clone 1H2

• Catalog Number: orb2294347
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CLK3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H2
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2b Kappa
• Immunogen: CLK3 (AAH02555, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
• NCBI: AAH02555
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLK3 monoclonal antibody (M01), clone 1H2 Western Blot analysis of CLK3 expression in Hela S3 NE.

CLK3 monoclonal antibody (M01), clone 1H2. Western Blot analysis of CLK3 expression in PC-12.

Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.2 ug/ml].

Western Blot detection against Immunogen (36.74 KDa).