You have no items in your shopping cart.
Cart summary
Item 1 of 1
CLIC2 monoclonal antibody (M01), clone 2C1
Catalog Number: orb2294351
| Catalog Number | orb2294351 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full-length recombinant CLIC2. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2C1 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | CLIC2 (AAH22305, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNITKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS |
| NCBI | AAH22305 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot analysis of CLIC2 expression in transfected 293T cell line by CLIC2 monoclonal antibody (M01), clone 2C1. Lane 1: CLIC2 transfected lysate (Predicted MW: 28.4 KDa). Lane 2: Non-transfected lysate.
