CLIC1 monoclonal antibody (M02), clone 3F9

• Catalog Number: orb2294353
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CLIC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
• NCBI: AAH64527.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CLIC1 monoclonal antibody (M02), clone 3F9 Western Blot analysis of CLIC1 expression in 293.

Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.15 ug/ml].

Western Blot analysis of CLIC1 expression in transfected 293T cell line by CLIC1 monoclonal antibody (M02), clone 3F9. Lane 1: CLIC1 transfected lysate(26.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (52.25 KDa).