You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294356 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CLIC1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2D4 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK |
NCBI | AAH64527.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CLIC1 monoclonal antibody (M01), clone 2D4 Western Blot analysis of CLIC1 expression in HL-60.
Detection limit for recombinant GST tagged CLIC1 is 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CLIC1 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 3 ug/ml].
Western Blot detection against Immunogen (52.25 KDa).