CLIC1 monoclonal antibody (M01J), clone 2D4

• Catalog Number: orb2294354
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CLIC1.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
• NCBI: AAH64527.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CLIC1 is 1 ng/ml as a capture antibody.

Detection limit for recombinant GST tagged CLIC1 is 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CLIC1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (52.25 KDa).