ClfA Protein, S. aureus (strain COL), Recombinant (His)

• Catalog Number: orb1976390
• Category: Proteins
• Description: Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. ClfA Protein, S. aureus (strain COL), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is Q5HHM8.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 38.0 kDa (predicted)
• UniProt ID: Q5HHM8
• Protein Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
• Expression System: P. pastoris (Yeast)
• Biological Origin: Staphylococcus aureus
• Biological Activity: Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. ClfA Protein, S. aureus (strain COL), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 38.0 kDa and the accession number is Q5HHM8.
• Expression Region: 229-559 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.