You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb526987 |
---|---|
Category | Antibodies |
Description | CLEC9A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IHC |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
UniProt ID | Q6UXN8 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | C-type lectin domain family 9 member A; CLEC9A; UN Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of Jurkat cells using anti-CLEC9A antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
ELISA, IF, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating