You have no items in your shopping cart.
Cart summary
CLEC4E Recombinant Protein (Mouse)
Catalog Number: orb2053027
| Catalog Number | orb2053027 |
|---|---|
| Category | Proteins |
| Description | CLEC4E Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 23.6 kDa |
| UniProt ID | Q9R0Q8 |
| Protein Sequence | TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD |
| Source | E.coli |
| NCBI | NP_064332 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | C86253;Clecs;Clecsf9;C-type (calcium dependent, ca Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Clec4e protein [orb383132]
Greater than 90% as determined by SDS-PAGE.
23.6 kDa
E.coli
20 μg, 100 μg, 1 mgCLEC4E Recombinant Protein (Mouse) [orb2053025]
Greater than 90% as determined by SDS-PAGE.
23.6 kDa
E.coli
20 μgCLEC4E Recombinant Protein (Mouse) [orb2053026]
Greater than 90% as determined by SDS-PAGE.
23.6 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
