CLDN10 MaxPab mouse polyclonal antibody (B01)

• Catalog Number: orb2291777
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CLDN10 protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: No additive
• Immunogen: CLDN10 (AAH10920, 1 a.a. ~ 228 a.a) full-length human protein.
• Protein Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
• Tested applications: WB
• Application notes: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH10920
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CLDN10 expression in transfected 293T cell line by CLDN10 MaxPab polyclonal antibody. Lane 1: CLDN10 transfected lysate (25.19 KDa). Lane 2: Non-transfected lysate.