You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 5
Item 1 of 5
CKMT1B monoclonal antibody (M04), clone 2C8
Catalog Number: orb2294390
| Catalog Number | orb2294390 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant CKMT1B. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
| Tested applications | ELISA, WB |
| Clone Number | 2C8 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_066270 |
Western Blot detection against Immunogen (35.75 KDa).
CKMT1B monoclonal antibody (M04), clone 2C8. Western Blot analysis of CKMT1B expression in A-431.
Detection limit for recombinant GST tagged CKMT1B is approximately 0.1 ng/ml as a capture antibody.
Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8. Lane 1: CKMT1B transfected lysate(47 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody (M04), clone 2C8 (Cat # orb2294390). GAPDH (36.1 kDa) used as specificity and loading control.
