You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294413 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CHUK. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CHUK (NP_001269, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
Tested applications | ELISA, IF, IHC-P, PLA, WB |
Clone Number | 2G4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001269 |
CHUK monoclonal antibody (M04), clone 2G4 Western Blot analysis of CHUK expression in Jurkat.
Immunofluorescence of monoclonal antibody to CHUK on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml].
Proximity Ligation Analysis of protein-protein interactions between IKBKB and CHUK. HeLa cells were stained with anti-IKBKB rabbit purified polyclonal 1:1200 and anti-CHUK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.63 KDa).