You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294423 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CHRNB2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C7 |
Tested applications | ELISA, WB |
Reactivity | Human, Rat |
Isotype | IgG2a Kappa |
Immunogen | CHRNB2 (NP_000739.1, 26 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS |
NCBI | NP_000739.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CHRNB2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CHRNB2 expression in rat testis.
Western Blot detection against Immunogen (37.29 KDa).