CHRNA5 monoclonal antibody (M01), clone 7D3

• Catalog Number: orb2294425
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CHRNA5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7D3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
• NCBI: NP_000736
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CHRNA5 is 0.3 ng/ml as a capture antibody.

Western Blot analysis of CHRNA5 expression in transfected 293T cell line by CHRNA5 monoclonal antibody (M01), clone 7D3. Lane 1: CHRNA5 transfected lysate (Predicted MW: 53.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.08 KDa).