CHRNA4 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294427
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CHRNA4 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CHRNA4 (AAH96292.1, 1 a.a. ~ 451 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI
• NCBI: AAH96292.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CHRNA4 expression in transfected 293T cell line by CHRNA4 MaxPab polyclonal antibody. Lane 1: CHRNA4 transfected lysate(49.90 KDa). Lane 2: Non-transfected lysate.