You have no items in your shopping cart.
Cart summary
CHRNA1 Recombinant Protein (Mouse)
Catalog Number: orb2054233
| Catalog Number | orb2054233 |
|---|---|
| Category | Proteins |
| Description | CHRNA1 Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 28.5 kDa |
| UniProt ID | P04756 |
| Protein Sequence | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
| Source | E.coli |
| NCBI | NP_031415 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | A;acetylcholine receptor subunit alpha;Achr;Achr-1 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Chrna1 protein [orb245792]
Greater than 90% as determined by SDS-PAGE.
26.5 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgMouse CHRNA1 protein [orb418712]
Greater than 90% as determined by SDS-PAGE.
28.5 kDa
E.coli
20 μg, 100 μg, 1 mgMouse CHRNA1 protein [orb418713]
Greater than 90% as determined by SDS-PAGE.
40.5 kDa
E.coli
20 μg, 100 μg, 1 mgCHRNA1 Recombinant Protein (Mouse) [orb2054234]
Greater than 90% as determined by SDS-PAGE.
28.5 kDa
E.coli
1 mgCHRNA1 Recombinant Protein (Mouse) [orb2054235]
Greater than 90% as determined by SDS-PAGE.
28.5 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars