You have no items in your shopping cart.
Cart summary
CHRNA1 Protein, Mouse, Recombinant (E. coli, His)
Catalog Number: orb1977434
| Catalog Number | orb1977434 |
|---|---|
| Category | Proteins |
| Description | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04756. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 28.5 kDa (predicted) |
| UniProt ID | P04756 |
| Protein Sequence | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04756. |
| Expression Region | 21-230 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
