CHN1 monoclonal antibody (M03), clone 3A3

• Catalog Number: orb2294438
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CHN1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP
• Tested applications: ELISA, WB
• Clone Number: 3A3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH11393

CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in HeLa.

CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in NIH/3T3.

CHN1 monoclonal antibody (M03), clone 3A3. Western Blot analysis of CHN1 expression in PC-12.

Detection limit for recombinant GST tagged CHN1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (37.84 KDa).