Chicken IFN alpha Recombinant Protein

• Catalog Number: orb1820684
• Category: Proteins
• Description: The Chicken IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN alpha Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CNHLRPQDAT FSHDSLQLLR DMAPTLPQLC PQHNASCSFN DTILDTSNTR QADKTTHDIL QHLFKILSSP STPAHWNDSQ RQSLLNRIHR YTQHLEQCLD SSDTRSRTRW PRNLHLTIKK HFSCLHTFLQ DNDYSACAWE HVRLQARAWF LHIHNLTGNT RT (162)) (Gene ID: 396398).
• Form/Appearance: Lyophilized
• Purity: 98%
• MW: 19.0 kDa
• Target: IFN alpha
• Entrez: 396398
• Protein Sequence: CNHLRPQDATFSHDSLQLLRDMAPTLPQLCPQHNASCSFNDTILDTSNTRQADKTTHDILQHLFKILSSPSTPAHWNDSQRQSLLNRIHRYTQHLEQCLDSSDTRSRTRWPRNLHLTIKKHFSCLHTFLQDNDYSACAWEHVRLQARAWFLHIHNLTGNTRT (162)
• Protein Length: 162
• Source: Yeast
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.