CHERP monoclonal antibody (M01), clone 2H5

• Catalog Number: orb2291549
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CHERP.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CHERP (AAH21294.1, 795 a.a. ~ 883 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARDEC
• NCBI: AAH21294.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CHERP monoclonal antibody (M01), clone 2H5 Western Blot analysis of CHERP expression in IMR-32.

Detection limit for recombinant GST tagged CHERP is 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (35.53 KDa).