CHD4 monoclonal antibody (M01A), clone 4H4

• Catalog Number: orb2294467
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CHD4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH
• NCBI: NP_001264
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CHD4 monoclonal antibody (M01A), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE.

Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody (M01A), clone 4H4. Lane 1: CHD4 transfected lysate(220 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).