You have no items in your shopping cart.
Cart summary
Item 1 of 1
CHAT monoclonal antibody (M01), clone 1H7
Catalog Number: orb2294481
| Catalog Number | orb2294481 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant CHAT. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1H7 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG1 Kappa |
| Immunogen | CHAT (NP_065574, 649 a.a. ~ 748 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP |
| NCBI | NP_065574 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (36.74 KDa).
