You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294497 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CFL2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CFL2 (NP_068733, 57 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 6G9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_068733 |
CFL2 monoclonal antibody (M03), clone 6G9 Western Blot analysis of CFL2 expression in HeLa.
Detection limit for recombinant GST tagged CFL2 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CFL2 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to CFL2 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 8 ug/ml].
Western Blot detection against Immunogen (37.84 KDa).