CETN2 polyclonal antibody (A02)

• Catalog Number: orb2294504
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant CETN2.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: CETN2 (NP_004335, 85 a.a. ~ 172 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• NCBI: NP_004335
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CETN2 polyclonal antibody (A02), Western Blot analysis of CETN2 expression in 293.

Western Blot detection against Immunogen (35.79 KDa).