CETN2 monoclonal antibody (M01), clone 3F8

• Catalog Number: orb2294502
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CETN2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CETN2 (NP_004335, 85 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• NCBI: NP_004335
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (35.42 KDa).

Detection limit for recombinant GST tagged CETN2 is approximately 0.1 ng/ml as a capture antibody.