You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294508 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CETN1 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | CETN1 (NP_004057.1, 1 a.a. ~ 172 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY |
NCBI | NP_004057.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CETN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CETN1 expression in mouse kidney.
Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 MaxPab polyclonal antibody. Lane 1: CETN1 transfected lysate(19.60 KDa). Lane 2: Non-transfected lysate.