CETN1 monoclonal antibody (M05), clone 4C12

• Catalog Number: orb2294506
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CETN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C12
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CETN1 (AAH29515.1, 16 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT
• NCBI: AAH29515.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 monoclonal antibody (M05), clone 4C12. Lane 1: CETN1 transfected lysate(19.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (34.32 KDa).