You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294509 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CETN1 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Reactivity | Human, Mouse |
Immunogen | CETN1 (NP_004057.1, 1 a.a. ~ 172 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY |
NCBI | NP_004057.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CETN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CETN1 expression in mouse kidney.
Immunoprecipitation of CETN1 transfected lysate using anti-CETN1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CETN1 purified MaxPab mouse polyclonal antibody (B01P) (orb2294510).
Western Blot analysis of CETN1 expression in transfected 293T cell line by CETN1 MaxPab polyclonal antibody. Lane 1: CETN1 transfected lysate(19.6 KDa). Lane 2: Non-transfected lysate.