CES2 monoclonal antibody (M02), clone 4F12

• Catalog Number: orb2291823
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CES2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F12
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CES2 (NP_003860, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
• NCBI: NP_003860
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CES2 monoclonal antibody (M02), clone 4F12 Western Blot analysis of CES2 expression in HepG2.

Detection limit for recombinant GST tagged CES2 is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CES2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.62 KDa).