CERK Rabbit Polyclonal Antibody

SKU: orb585870

Description

CERK Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CERK. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human CERK. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CERK
• Target: CERK
• Protein Sequence: Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

LK4, hCERK, dA59H18.2, dA59H18.3

Quick Database Links

Gene Symbol

CERK

UniProt

Q8TCT0

RefSeq (Protein):NP_073603