CEP68 Antibody

• Catalog Number: orb413082
• Category: Antibodies
• Description: CEP68 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 81 kDa
• UniProt ID: Q76N32
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Centrosomal protein of 68 kDa; Cep68; CEP68; KIAA0
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of CEP68 using anti-CEP68 antibody.Lane 1:human HeLa cell;2:human COLO-320 cell;3:human SK-OV-3 cell;4:human Jurkat cell;5:rat heart tissue;6:mouse heart tissue.