CEBPE monoclonal antibody (M01), clone 7A4

• Catalog Number: orb2294524
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CEBPE.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7A4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
• NCBI: AAH35797.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4. Lane 1: CEBPE transfected lysate(30.6 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CEBPE monoclonal antibody (M01), clone 7A4 (Cat # orb2294524). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (56.65 KDa).