CDX4 monoclonal antibody (M12), clone 1E9

• Catalog Number: orb2294531
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CDX4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
• Tested applications: ELISA, IF, WB
• Clone Number: 1E9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005184

CDX4 monoclonal antibody (M12), clone 1E9 Western Blot analysis of CDX4 expression in HeLa.

CDX4 monoclonal antibody (M12), clone 1E9. Western Blot analysis of CDX4 expression in PC-12.

CDX4 monoclonal antibody (M12), clone 1E9. Western Blot analysis of CDX4 expression in Raw 264.7.

Immunofluorescence of monoclonal antibody to CDX4 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (35.13 KDa).