You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294542 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDX4. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In ascites fluid |
Immunogen | CDX4 (NP_005184.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT |
Tested applications | ELISA, WB |
Clone Number | 1G12 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005184.1 |
Western Blot detection against Immunogen (36.74 KDa).
CDX4 monoclonal antibody (M01A), clone 1G12 Western Blot analysis of CDX4 expression in HeLa.
CDX4 monoclonal antibody (M01A), clone 1G12. Western Blot analysis of CDX4 expression in NIH/3T3.
CDX4 monoclonal antibody (M01A), clone 1G12. Western Blot analysis of CDX4 expression in PC-12.
CDX4 monoclonal antibody (M01A), clone 1G12. Western Blot analysis of CDX4 expression in Raw 264.7.