You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294549 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CDX2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1C7 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG |
Immunogen | CDX2 (AAH14461.1, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
NCBI | AAH14461.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CDX2 monoclonal antibody (M01), clone 1C7 Western Blot analysis of CDX2 expression in COLO 320 HSR.
CDX2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CDX2 expression in human parotid gland.
Detection limit for recombinant GST tagged CDX2 is approximately 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (60.17 KDa).