CDS2 monoclonal antibody (M01), clone 2B9

• Catalog Number: orb2291835
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
• NCBI: NP_003809
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDS2 monoclonal antibody (M01), clone 2B9. Western Blot analysis of CDS2 expression in human kidney.

Detection limit for recombinant GST tagged CDS2 is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (33.11 KDa).