CDR2 monoclonal antibody (M01), clone 4F5

• Catalog Number: orb2294563
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CDR2 (NP_001793, 296 a.a. ~ 404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWE
• NCBI: NP_001793
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDR2 monoclonal antibody (M01), clone 4F5 Western Blot analysis of CDR2 expression in HeLa.

CDR2 monoclonal antibody (M01), clone 4F5. Western Blot analysis of CDR2 expression in K-562.

Detection limit for recombinant GST tagged CDR2 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDR2 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (37.73 KDa).