CDKN2D purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294571
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CDKN2D protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: CDKN2D (NP_001791.1, 1 a.a. ~ 166 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
• NCBI: NP_001791.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of purified MaxPab antibody to CDKN2D on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D MaxPab polyclonal antibody. Lane 1: CDKN2D transfected lysate(17.70 KDa). Lane 2: Non-transfected lysate.