CDKN2D monoclonal antibody (M08), clone 2E10

• Catalog Number: orb2294570
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CDKN2D.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E10
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CDKN2D (AAH01822, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
• NCBI: AAH01822
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CDKN2D is 0.1 ng/ml as a capture antibody.

Immunoprecipitation of CDKN2D transfected lysate using anti-CDKN2D monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDKN2D MaxPab rabbit polyclonal antibody.

Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10. Lane 1: CDKN2D transfected lysate(17.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (44 KDa).